PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.9G580500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 443aa    MW: 46459.2 Da    PI: 5.4275
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.9G580500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2545.4e-78904372374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ve+L e+A+  ++gd   a+++L  +       g+p+ R a y++ AL+  l++       + ++ + ++   +++l a+k+fse+sP+l+
  Sevir.9G580500.1.p  90 VEQLAEAATLAEAGDVLGARETLLAMAPDIGAPGTPLLRSALYLKDALRVALSG-------SSSSANPNSVVLIKKLGAYKAFSEISPVLQ 173
                         789**************************************************9.......222233333459****************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlva 183
                         f+h+t+ qa+l+ ++ + ++H++D+di+ G QW++L+++La R+ + + l++T+++s +   + el+ ++++L++fA+e++v+f+f +l  
  Sevir.9G580500.1.p 174 FAHFTCVQAVLDHLAAAACIHVLDLDIGVGDQWASLMHELARRR-PGAALKVTALVSGT--ASLELQLVHDNLSSFAAETRVQFRFAALNL 261
                         *****************************************985.5589********44..99*************************944 PP

                GRAS 184 krledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                         ++++  el +++  +gEa+aV+l     r +            vL+lv++l +k+vv v++ +d+++ +F++++l+a+++++++++s++a 
  Sevir.9G580500.1.p 262 DAVNPAELLAIAAGEGEAIAVHLPAGSVRGP------------VLELVRRLGAKLVVSVDRGCDRGELPFAAHLLQAFQWCASMLESMDAV 340
                         444444444556666*********9877777............************************************************ PP

                GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveee.sgslvlgWkd 364
                         +++ s    ++Er +++++++++v  + ++  ++ e+   Wr++l +aGF pvp s++a++qa++l++kv+++g+rv+++  g+lvl W++
  Sevir.9G580500.1.p 341 VGAGS---DVIERLVIQPRVESCVLRRYRA-AANGEKTPPWRAMLASAGFVPVPASSFAEAQADSLVKKVPVRGFRVQKRgAGELVLHWQR 427
                         97766...58*******************9.99999******************************************987899******* PP

                GRAS 365 rpLvsvSaWr 374
                          +L+svSaWr
  Sevir.9G580500.1.p 428 GELLSVSAWR 437
                         *********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098535.97263416IPR005202Transcription factor GRAS
PfamPF035141.9E-7590437IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 443 aa     Download sequence    Send to blast
MPLGAAEACC WEAPCAAAQP QEDNTFLRWI IGGDDGSSAV MDHIPASSAH QPLPSLPPLD  60
TPPPPNFALK PNAEAEAEAA NDDTTAALAV EQLAEAATLA EAGDVLGARE TLLAMAPDIG  120
APGTPLLRSA LYLKDALRVA LSGSSSSANP NSVVLIKKLG AYKAFSEISP VLQFAHFTCV  180
QAVLDHLAAA ACIHVLDLDI GVGDQWASLM HELARRRPGA ALKVTALVSG TASLELQLVH  240
DNLSSFAAET RVQFRFAALN LDAVNPAELL AIAAGEGEAI AVHLPAGSVR GPVLELVRRL  300
GAKLVVSVDR GCDRGELPFA AHLLQAFQWC ASMLESMDAV VGAGSDVIER LVIQPRVESC  360
VLRRYRAAAN GEKTPPWRAM LASAGFVPVP ASSFAEAQAD SLVKKVPVRG FRVQKRGAGE  420
LVLHWQRGEL LSVSAWRLTS SS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2312343737375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012704690.10.0PREDICTED: scarecrow-like protein 6
TrEMBLK4AA220.0K4AA22_SETIT; Uncharacterized protein
STRINGSi035728m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67232954
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-63GRAS family protein